Skip to content
Skip to breadcrumbs
Skip to header menu
Skip to action menu
Skip to quick search

Skip to end of banner Go to start of banner

Ab5-tubb

Skip to end of metadata

Created by Web Service User, last modified on Apr 05, 2015

Go to start of metadata

You are viewing an old version of this page. View the current version.

Compare with Current View Page History

Error rendering macro 'show-if'

Failed to render Visibility macro due to: @authenticated is not a valid user

Assays Tested

Assay	Prep	Worked	Notes

Notes

Imported from ZFIN Antibody page Ab5-tubb
Immunogen sequence was "YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF", from human TUBB. (Tapanes-Castillo, A., Shabazz, F.S., Mboge, M.Y., Vajn, K., Oudega, M., and Plunkett, J.A.)
Citations for Ab5-tubb at ZFIN

No labels