Antibody Name: |
Ab5-tubb from the ZFIN antibody database. |
---|---|
Other names, clone ids, catalog ids etc. |
Anti-TUBB antibody produced in rabbit , SAB2102604 , tubb |
Antibody Registry ID. |
AB_10605874 |
Does it work on zebrafish? |
yes |
Host organism |
Rabbit |
Immunogen organism |
Human |
Antibody isotype |
|
Antibody type |
polyclonal |
Anatomical structures recognized |
|
Recognized target molecules (gene names, domains, epitopes ...) |
|
Suppliers |
Assays Tested
Assay |
Prep |
Worked |
Notes |
---|
Notes
- Imported from ZFIN Antibody page Ab5-tubb
- Immunogen sequence was "YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF", from human TUBB. (Tapanes-Castillo, A., Shabazz, F.S., Mboge, M.Y., Vajn, K., Oudega, M., and Plunkett, J.A.)
- Citations for Ab5-tubb at ZFIN