Skip to end of metadata
Go to start of metadata

You are viewing an old version of this page. View the current version.

Compare with Current View Page History

« Previous Version 29 Next »

Antibody Name:

Ab1-scg2a from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

anti-secretoneurin a , anti-SNa , scg2a

Antibody Registry ID.

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Goldfish

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

hypophysis

Recognized target molecules (gene names, domains, epitopes ...)

scg2a  

Suppliers

Assays Tested

Assay

Prep

Worked

Notes

western blot

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab1-scg2a
  • In zebrafish and other teleost fishes, two paralogous genes, scg2a and scg2b, generate secretoneurin peptides SNa and SNb, respectively (Zhao et al., 2010, PMID: 20006654). SNa antiserum was raised against a peptide derived from golfish SNa (YTPQKLATLQSVFEE). This antibody recognizes zebrafish SNa but not SNb. goldfish SNa: TNENAEEQYTPQKLATLQSVFEELSGIAASNANS zebrafish SNa: TNENAEEQYTPQKLATLQSVFEELSGIASSKTNT zebrafish SNb: ATEDLDEQYTPQSLANMRSIFEELGKLSAAQ (Tao, B., Hu, H., Mitchell, K., Chen, J., Jia, H., Zhu, Z., Trudeau, V.L., Hu, W.)
  • Citations for Ab1-scg2a at ZFIN
  • No labels