Antibody Name: |
Ab1-scg2a from the ZFIN antibody database. |
---|---|
Other names, clone ids, catalog ids etc. |
anti-secretoneurin a , anti-SNa , scg2a |
Antibody Registry ID. |
|
Does it work on zebrafish? |
yes |
Host organism |
Rabbit |
Immunogen organism |
Goldfish |
Antibody isotype |
|
Antibody type |
polyclonal |
Anatomical structures recognized |
|
Recognized target molecules (gene names, domains, epitopes ...) |
|
Suppliers |
|
Assays Tested
Assay |
Prep |
Worked |
Notes |
---|---|---|---|
western blot | yes | from ZFIN curation |
Notes
- Imported from ZFIN Antibody page Ab1-scg2a
- In zebrafish and other teleost fishes, two paralogous genes, scg2a and scg2b, generate secretoneurin peptides SNa and SNb, respectively (Zhao et al., 2010, PMID: 20006654). SNa antiserum was raised against a peptide derived from golfish SNa (YTPQKLATLQSVFEE). This antibody recognizes zebrafish SNa but not SNb. goldfish SNa: TNENAEEQYTPQKLATLQSVFEELSGIAASNANS zebrafish SNa: TNENAEEQYTPQKLATLQSVFEELSGIASSKTNT zebrafish SNb: ATEDLDEQYTPQSLANMRSIFEELGKLSAAQ (Tao, B., Hu, H., Mitchell, K., Chen, J., Jia, H., Zhu, Z., Trudeau, V.L., Hu, W.)
- Citations for Ab1-scg2a at ZFIN