Skip to end of metadata
Go to start of metadata

You are viewing an old version of this page. View the current version.

Compare with Current View Page History

« Previous Version 19 Next »

Antibody Name:

Ab1-scg2a from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

anti-secretoneurin a , anti-SNa , scg2a

Antibody Registry ID.

Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype

Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)


Recognized target molecules (gene names, domains, epitopes ...)



Assays Tested





western blot


from ZFIN curation


  • Imported from ZFIN Antibody page Ab1-scg2a
  • In zebrafish and other teleost fishes, two paralogous genes, scg2a and scg2b, generate secretoneurin peptides SNa and SNb, respectively (Zhao et al., 2010, PMID: 20006654). SNa antiserum was raised against a peptide derived from golfish SNa (YTPQKLATLQSVFEE). This antibody recognizes zebrafish SNa but not SNb. goldfish SNa: TNENAEEQYTPQKLATLQSVFEELSGIAASNANS zebrafish SNa: TNENAEEQYTPQKLATLQSVFEELSGIASSKTNT zebrafish SNb: ATEDLDEQYTPQSLANMRSIFEELGKLSAAQ (Tao, B., Hu, H., Mitchell, K., Chen, J., Jia, H., Zhu, Z., Trudeau, V.L., Hu, W.)
  • Citations for Ab1-scg2a at ZFIN
  • No labels