Ab1-ppara

Error rendering macro 'show-if'

Failed to render Visibility macro due to: @authenticated is not a valid user

Antibody Name:	Ab1-ppara from the ZFIN antibody database.
Other names, clone ids, catalog ids etc.	Ppara antibody - C-terminal region (ARP34068_P050) , ppara
Does it work on zebrafish?	yes
Host organism	Rabbit
Immunogen organism	Rat
Antibody isotype
Antibody type	polyclonal
Anatomical structures recognized (use terms from the ZFIN Anatomical Ontology)	whole organism
Recognized target molecules (gene names, domains, epitopes ...)
Suppliers	Aviva Systems Biology

Assay	Prep	Worked	Notes
western blot		yes	from ZFIN curation

Imported from ZFIN Antibody page Ab1-ppara
Immunogen was a synthetic peptide located within the following region: LHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPL (ZFIN Staff)
Citations for Ab1-ppara at ZFIN