Antibody Name: |
Ab1-ppara from the ZFIN antibody database. |
---|---|
Other names, clone ids, catalog ids etc. |
Ppara antibody - C-terminal region (ARP34068_P050) , ppara |
Does it work on zebrafish? |
yes |
Host organism |
Rabbit |
Immunogen organism |
Rat |
Antibody isotype |
|
Antibody type |
polyclonal |
Anatomical structures recognized |
|
Recognized target molecules (gene names, domains, epitopes ...) |
|
Suppliers |
Assays Tested
Assay |
Prep |
Worked |
Notes |
---|---|---|---|
western blot | yes | from ZFIN curation |
Notes
- Imported from ZFIN Antibody page Ab1-ppara
- Immunogen was a synthetic peptide located within the following region: LHLQSNHPDDTFLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPL (ZFIN Staff)
- Citations for Ab1-ppara at ZFIN