Ab5-tubb

Error rendering macro 'show-if'

Failed to render Visibility macro due to: @authenticated is not a valid user

Antibody Name:	Ab5-tubb from the ZFIN antibody database.
Other names, clone ids, catalog ids etc.	Anti-TUBB antibody produced in rabbit , SAB2102604 , tubb
Does it work on zebrafish?	yes
Host organism	Rabbit
Immunogen organism	Human
Antibody isotype
Antibody type	polyclonal
Anatomical structures recognized (use terms from the ZFIN Anatomical Ontology)
Recognized target molecules (gene names, domains, epitopes ...)
Suppliers	Sigma-Aldrich

Assay	Prep	Worked	Notes

Imported from ZFIN Antibody page Ab5-tubb
Immunogen sequence was "YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF", from human TUBB. (Tapanes-Castillo, A., Shabazz, F.S., Mboge, M.Y., Vajn, K., Oudega, M., and Plunkett, J.A.)
Citations for Ab5-tubb at ZFIN