Versions Compared

Key

  • This line was added.
  • This line was removed.
  • Formatting was changed.
Show If
special@authenticated

Add Page via Form
parent@home
linkTextCreate New Antibody
sourcecommunity-antibody
labelscommunity_antibody

Link to Location
add comment
add comment
linkTextAdd Comment

Antibody Name:

Ab2-tial1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

NBP1-79932 , tial1

Antibody Registry ID.

AB_11036093

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Novus Biologicals, LLC

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab2-tial1
  • Immunogen was a synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. (ZFIN Staff)
  • Citations for Ab2-tial1 at ZFIN