Versions Compared


  • This line was added.
  • This line was removed.
  • Formatting was changed.
Show If

Add Page via Form
linkTextCreate New Antibody

Link to Location
add comment
add comment
linkTextAdd Comment

Antibody Name:

Ab1-lbx from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

ab90839 , Anti-LBX1 antibody , lbx

Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype


Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

pelvic fin bud muscle cell

Recognized target molecules (gene names, domains, epitopes ...)


Abcam plc

Assays Tested







from ZFIN curation


  • Imported from ZFIN Antibody page Ab1-lbx
  • Immunogen was a synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 (PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGR DGMTIFGQRQT) (NP_006553) (ZFIN Staff)
  • Citations for Ab1-lbx at ZFIN