Child pages
  • Ab1-mks1

Versions Compared

Key

  • This line was added.
  • This line was removed.
  • Formatting was changed.
Show If
users@authenticated

Add Page via Form
parentDefaultLink[destination=Optional[PageResourceIdentifier[spaceKey=<null>,title=@home]],body=Optional.empty,tooltip=Optional.empty,anchor=Optional.empty,target=Optional.empty]
linkTextCreate New Antibody
sourcecommunity-antibody
labelscommunity_antibody

Link to Location
add comment
add comment
linkTextAdd Comment

Antibody Name:

Ab1-mks1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-MKS1 antibody produced in rabbit , HPA021812 , mks1

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Atlas Antibodies AB  Sigma-Aldrich

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab1-mks1
  • This antibody was generated by the Human Protein Atlas project (HPA). The Immunogen sequence was TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA. (ZFIN Staff)
  • Citations for Ab1-mks1 at ZFIN