Versions Compared


  • This line was added.
  • This line was removed.
  • Formatting was changed.
Show If

Add Page via Form
linkTextCreate New Antibody

Link to Location
add comment
add comment
linkTextAdd Comment

Antibody Name:

Ab1-scg2a from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

anti-secretoneurin a , anti-SNa , scg2a

Antibody Registry ID.

Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype

Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)


Recognized target molecules (gene names, domains, epitopes ...)



Assays Tested





western blot


from ZFIN curation


  • Imported from ZFIN Antibody page Ab1-scg2a
  • In zebrafish and other teleost fishes, two paralogous genes, scg2a and scg2b, generate secretoneurin peptides SNa and SNb, respectively (Zhao et al., 2010, PMID: 20006654). SNa antiserum was raised against a peptide derived from golfish SNa (YTPQKLATLQSVFEE). This antibody recognizes zebrafish SNa but not SNb. goldfish SNa: TNENAEEQYTPQKLATLQSVFEELSGIAASNANS zebrafish SNa: TNENAEEQYTPQKLATLQSVFEELSGIASSKTNT zebrafish SNb: ATEDLDEQYTPQSLANMRSIFEELGKLSAAQ (Tao, B., Hu, H., Mitchell, K., Chen, J., Jia, H., Zhu, Z., Trudeau, V.L., Hu, W.)
  • Citations for Ab1-scg2a at ZFIN