Show If | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
| ||||||||||
|
Link to Location | ||||||
---|---|---|---|---|---|---|
|
Antibody Name: | Ab5-tubb from the ZFIN antibody database. |
---|---|
Other names, clone ids, catalog ids etc. | Anti-TUBB antibody produced in rabbit , SAB2102604 , tubb |
Does it work on zebrafish? | yes |
Host organism | Rabbit |
Immunogen organism | Human |
Antibody isotype | |
Antibody type | polyclonal |
Anatomical structures recognized | |
Recognized target molecules (gene names, domains, epitopes ...) | |
Suppliers |
Assays Tested
Assay | Prep | Worked | Notes |
---|
Notes
- Imported from ZFIN Antibody page Ab5-tubb
- Immunogen sequence was "YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF", from human TUBB. (Tapanes-Castillo, A., Shabazz, F.S., Mboge, M.Y., Vajn, K., Oudega, M., and Plunkett, J.A.)
- Citations for Ab5-tubb at ZFIN