Child pages
  • Anti-Human GAMT Antibody
Skip to end of metadata
Go to start of metadata

Antibody Name (copy page name from title above)

Anti-Human GAMT  Antibody
Other names, clone ids, catalog ids etc.Rabbit Anti-Human GAMT Polyclonal antibody ;CPBT-33731RH
Does it work on zebrafish? (Yes or No)yes
Host organismRabbit
Immunogen organismGAMT fusion protein, sequence: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYMHALAAAASSKGGRVLEVGFGMAIAASKVQEAPIDEHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQFNFIKNHAFRLLKPGGVLTYCNLTSWGELMKSKYSDITIMFEETQVPALLEAGFRRENIRTEVMALVPPADCRYYAFPQMITPLVTKG (1-236aa encoded by BC016760)
Antibody isotypeIgG
Antibody type (monocional, polycional, or none)Polyclonal
Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...) GAMT

Recognized ZFIN genes
current ZFIN-gene symbols only ZFIN Gene Search


Supplier(s)Creative Diagnostics


Assays Tested

Assay
(ChIP, IHC, IP or WB)
PrepWorked
(Yes or No)
Notes





Submitter Note

(Add note here)

  • No labels