Skip to end of metadata
Go to start of metadata

Antibody Name (copy page name from title above)

Anti-Cow MMP2  Antibody
Other names, clone ids, catalog ids etc.Rabbit Anti-Human MMP2 Polyclonal antibody ;CPBT-55715RC
Does it work on zebrafish? (Yes or No)yes
Host organismRabbit
Immunogen organismMMP2 fusion protein, sequence: LGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC (461-660 aa encoded by BC002576)
Antibody isotypeIgG
Antibody type (monocional, polycional, or none)Polyclonal
Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)
MMP2
Recognized target molecules (gene names, domains, epitopes ...)

Recognized ZFIN genes
current ZFIN-gene symbols only ZFIN Gene Search


Supplier(s)Creative Diagnostics


Assays Tested

Assay
(ChIP, IHC, IP or WB)
PrepWorked
(Yes or No)
Notes
 WB, IP, IHC, IF, ELISA



Submitter Note

(Add note here)

  • No labels