Skip to end of metadata
Go to start of metadata

Antibody Name:

Ab5-egfr from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

06-847 , Anti-EGFR Antibody , egfr

Antibody Registry ID.

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Mouse

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Sigma-Aldrich

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab5-egfr
  • Immunogen was ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). (ZFIN Staff)
  • Citations for Ab5-egfr at ZFIN