Antibody Name: |
Ab5-egfr from the ZFIN antibody database. |
|---|---|
Other names, clone ids, catalog ids etc. |
06-847 , Anti-EGFR Antibody , egfr |
Antibody Registry ID. |
|
Does it work on zebrafish? |
yes |
Host organism |
Rabbit |
Immunogen organism |
Mouse |
Antibody isotype |
IgG |
Antibody type |
polyclonal |
Anatomical structures recognized |
|
Recognized target molecules (gene names, domains, epitopes ...) |
|
Suppliers |
Assays Tested
Assay |
Prep |
Worked |
Notes |
|---|
Notes
- Imported from ZFIN Antibody page Ab5-egfr
- Immunogen was ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). (ZFIN Staff)
- Citations for Ab5-egfr at ZFIN