Child pages
  • Ab4-rac1
Skip to end of metadata
Go to start of metadata

Error rendering macro 'table-plus' : Notify your Confluence administrator that "Bob Swift Atlassian Add-ons - Advanced Tables" requires a valid license. Reason: VERSION_MISMATCH

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab4-rac1
  • Immunogen was a recombinant full length protein corresponding to Human Rac1. Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL (ZFIN Staff)
  • Citations for Ab4-rac1 at ZFIN