Child pages
  • Ab4-rac1
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab4-rac1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-Rac1 antibody (ab155938) , rac1

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab4-rac1
  • Immunogen was a recombinant full length protein corresponding to Human Rac1. Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKP VNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL (ZFIN Staff)
  • Citations for Ab4-rac1 at ZFIN