Child pages
  • Ab3-tp63
Skip to end of metadata
Go to start of metadata

The license could not be verified: There is no license certificate installed for CustomWare Linking Plugin for Confluence. Generate a Free license now.

Antibody Name:

Ab3-tp63 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

p63a Antibody (H-129): sc-8344 , tp63

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Santa Cruz Biotechnology, Inc.

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab3-tp63
  • Immunogen was an epitope corresponding to amino acids 513-641 mapping at the C-terminus of TA* p63a of human origin. "AGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDA" (ZFIN Staff)
  • Citations for Ab3-tp63 at ZFIN