Child pages
  • Ab3-tp63
Skip to end of metadata
Go to start of metadata

Error rendering macro 'table-plus' : Notify your Confluence administrator that "Bob Swift Atlassian Add-ons - Advanced Tables" requires a valid license. Reason: VERSION_MISMATCH

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab3-tp63
  • Immunogen was an epitope corresponding to amino acids 513-641 mapping at the C-terminus of TA* p63a of human origin. "AGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIVSFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKGILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDA" (ZFIN Staff)
  • Citations for Ab3-tp63 at ZFIN