Skip to end of metadata
Go to start of metadata

Antibody Name:

Ab3-myh9 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-non-muscle Myosin IIA antibody ab55456 , mouse anti-NMII , myh9

Antibody Registry ID.


Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype

IgG2b , k

Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

external yolk syncytial layer actomyosin

Recognized target molecules (gene names, domains, epitopes ...)


Abcam plc

Assays Tested







from ZFIN curation


  • Imported from ZFIN Antibody page Ab3-myh9
  • Immunogen was a recombinant fragment (GST-tag) corresponding to Human non-muscle Myosin IIA aa 1871- 1960. Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE (ZFIN Staff)
  • Citations for Ab3-myh9 at ZFIN