Child pages
  • Ab3-myh9
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab3-myh9 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-non-muscle Myosin IIA antibody ab55456 , mouse anti-NMII , myh9

Does it work on zebrafish?

yes

Host organism

Mouse

Immunogen organism

Human

Antibody isotype

IgG2b , k

Antibody type

monoclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Abcam plc

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab3-myh9
  • Immunogen was a recombinant fragment (GST-tag) corresponding to Human non-muscle Myosin IIA aa 1871- 1960. Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE (ZFIN Staff)
  • Citations for Ab3-myh9 at ZFIN