Child pages
  • Ab3-myh9
Skip to end of metadata
Go to start of metadata

The license could not be verified: License Certificate has expired! Generate a Free license now.

Antibody Name:

Ab3-myh9 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-non-muscle Myosin IIA antibody ab55456 , mouse anti-NMII , myh9

Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype

IgG2b , k

Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)


Abcam plc

Assays Tested






  • Imported from ZFIN Antibody page Ab3-myh9
  • Immunogen was a recombinant fragment (GST-tag) corresponding to Human non-muscle Myosin IIA aa 1871- 1960. Sequence: RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE (ZFIN Staff)
  • Citations for Ab3-myh9 at ZFIN