Child pages
  • Ab2-tp63
Skip to end of metadata
Go to start of metadata

The license could not be verified: There is no license certificate installed for CustomWare Linking Plugin for Confluence. Generate a Free license now.

Antibody Name:

Ab2-tp63 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

p63 Antibody (H-137): sc-8343 , tp63

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

epidermal basal stratum; jaw row breeding tubercle; unspecified; whole organism

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Santa Cruz Biotechnology, Inc.

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab2-tp63
  • Immunogen was an epitope corresponding to amino acids 15-151 of deltaN p63a of human origin. "PDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFLSPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQDSDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYAQ" (ZFIN Staff)
  • Citations for Ab2-tp63 at ZFIN