Child pages
  • Ab2-tial1
Skip to end of metadata
Go to start of metadata

The license could not be verified: There is no license certificate installed for CustomWare Linking Plugin for Confluence. Generate a Free license now.

Antibody Name:

Ab2-tial1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

NBP1-79932 , tial1

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Novus Biologicals, LLC

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab2-tial1
  • Immunogen was a synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. (ZFIN Staff)
  • Citations for Ab2-tial1 at ZFIN