Child pages
  • Ab2-tial1
Skip to end of metadata
Go to start of metadata

Error rendering macro 'table-plus' : Notify your Confluence administrator that "Bob Swift Atlassian Add-ons - Advanced Tables" requires a valid license. Reason: VERSION_MISMATCH

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab2-tial1
  • Immunogen was a synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. (ZFIN Staff)
  • Citations for Ab2-tial1 at ZFIN