Skip to end of metadata
Go to start of metadata

Antibody Name:

Ab2-tial1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

NBP1-79932 , tial1

Antibody Registry ID.


Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype

Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)


Novus Biologicals, LLC

Assays Tested







from ZFIN curation


  • Imported from ZFIN Antibody page Ab2-tial1
  • Immunogen was a synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. (ZFIN Staff)
  • Citations for Ab2-tial1 at ZFIN