Child pages
  • Ab2-chrm2
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab2-chrm2 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

AMR-002 , Anti-M2 Muscarinic Receptor Antibody Cholinergic Muscarinic Receptor 2, Chrm2 , chrm2

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Alomone Labs, Ltd.

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab2-chrm2
  • Immunogen was a protein with a sequence VANQDPVSPSLVQGRIVKPN NNNMPSSDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSV SAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKS DSCTPTNTTVEVVGSSGQNGDE, corresponding to amino acid residues 225-356 of human m2 (Accession P08172). (ZFIN Staff)
  • Citations for Ab2-chrm2 at ZFIN