Child pages
  • Ab1-mtm1
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab1-mtm1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-MTM1 antibody produced in rabbit , HPA010008 , mtm1

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

skeletal muscle T-tubule; whole organism

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Sigma-Aldrich

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

western blot

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab1-mtm1
  • Immunogen was this portion of the human mtm1 gene "KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK". (ZFIN Staff)
  • Citations for Ab1-mtm1 at ZFIN