Child pages
  • Ab1-mtm1
Skip to end of metadata
Go to start of metadata

Error rendering macro 'table-plus' : Notify your Confluence administrator that "Bob Swift Atlassian Add-ons - Advanced Tables" requires a valid license. Reason: VERSION_MISMATCH

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

western blot

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab1-mtm1
  • Immunogen was this portion of the human mtm1 gene "KFNVDGWTVYNPVEEYRRQGLPNHHWRITFINKCYELCDTYPALLVVPYRASDDDLRRVATFRSRNRIPVLSWIHPENKTVIVRCSQPLVGMSGKRNKDDEKYLDVIRETNKQISKLTIYDARPSVNAVANK". (ZFIN Staff)
  • Citations for Ab1-mtm1 at ZFIN