Child pages
  • Ab1-mks1
Skip to end of metadata
Go to start of metadata

The license could not be verified: There is no license certificate installed for CustomWare Linking Plugin for Confluence. Generate a Free license now.

Antibody Name:

Ab1-mks1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-MKS1 antibody produced in rabbit , HPA021812 , mks1

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Atlas Antibodies AB  Sigma-Aldrich

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab1-mks1
  • This antibody was generated by the Human Protein Atlas project (HPA). The Immunogen sequence was TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA. (ZFIN Staff)
  • Citations for Ab1-mks1 at ZFIN