Child pages
  • Ab1-mks1
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab1-mks1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-MKS1 antibody produced in rabbit , HPA021812 , mks1

Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype


Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)


Atlas Antibodies AB  Sigma-Aldrich

Assays Tested






  • Imported from ZFIN Antibody page Ab1-mks1
  • This antibody was generated by the Human Protein Atlas project (HPA). The Immunogen sequence was TCTTKSLAMDKVAHFSYPFTFEAFFLHEDESSDALPEWPVLYCEVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPVELGTVA. (ZFIN Staff)
  • Citations for Ab1-mks1 at ZFIN