Child pages
  • Ab1-lbx
Skip to end of metadata
Go to start of metadata

Error rendering macro 'table-plus' : Notify your Confluence administrator that "Bob Swift Atlassian Add-ons - Advanced Tables" requires a valid license. Reason: VERSION_MISMATCH

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab1-lbx
  • Immunogen was a synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 (PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGR DGMTIFGQRQT) (NP_006553) (ZFIN Staff)
  • Citations for Ab1-lbx at ZFIN