Child pages
  • Ab1-lbx
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab1-lbx from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

ab90839 , Anti-LBX1 antibody , lbx

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

IgG

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

pelvic fin bud muscle cell

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Abcam plc

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab1-lbx
  • Immunogen was a synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 (PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGR DGMTIFGQRQT) (NP_006553) (ZFIN Staff)
  • Citations for Ab1-lbx at ZFIN