Skip to end of metadata
Go to start of metadata

Antibody Name:

Ab1-lbx from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

ab90839 , Anti-LBX1 antibody , lbx

Antibody Registry ID.


Does it work on zebrafish?


Host organism


Immunogen organism


Antibody isotype


Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

pelvic fin bud muscle cell

Recognized target molecules (gene names, domains, epitopes ...)


Abcam plc

Assays Tested







from ZFIN curation


  • Imported from ZFIN Antibody page Ab1-lbx
  • Immunogen was a synthetic peptide corresponding to a region of Human LBX1 within internal sequence amino acids 72-121 (PLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGR DGMTIFGQRQT) (NP_006553) (ZFIN Staff)
  • Citations for Ab1-lbx at ZFIN