Child pages
  • Ab1-ihh
Skip to end of metadata
Go to start of metadata

Antibody Name:

Ab1-ihh from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Indian Hedgehog/Ihh Antibody , NBP1-59443 , ihh

Antibody Registry ID.


Does it work on zebrafish?


Host organism


Immunogen organism

Fruit fly

Antibody isotype

Antibody type


Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Meckel's cartilage chondrocyte

Recognized target molecules (gene names, domains, epitopes ...)


Novus Biologicals, LLC

Assays Tested







from ZFIN curation


  • Imported from ZFIN Antibody page Ab1-ihh
  • Immunogen was synthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR. (ZFIN Staff)
  • Citations for Ab1-ihh at ZFIN