Child pages
  • Ab1-ihh
Skip to end of metadata
Go to start of metadata

The license could not be verified: There is no license certificate installed for CustomWare Linking Plugin for Confluence. Generate a Free license now.

Antibody Name:

Ab1-ihh from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Indian Hedgehog/Ihh Antibody , NBP1-59443 , ihh

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Fruit fly

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Meckel's cartilage chondrocyte

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Novus Biologicals, LLC

Assays Tested

Assay

Prep

Worked

Notes

immunohistochemistry

yes

from ZFIN curation

Notes

  • Imported from ZFIN Antibody page Ab1-ihh
  • Immunogen was synthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR. (ZFIN Staff)
  • Citations for Ab1-ihh at ZFIN