Skip to end of metadata
Go to start of metadata

Antibody Name:

Ab1-gck from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

Anti-GCK antibody produced in rabbit , HPA007093 , gck

Antibody Registry ID.

AB_1079051

Does it work on zebrafish?

yes

Host organism

Rabbit

Immunogen organism

Human

Antibody isotype

Antibody type

polyclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Sigma-Aldrich

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab1-gck
  • Immunogen was GCK from human. with the following sequence. DLGGTNFRVMLVKVGEGEEGQWSVKTKHQMYSIPEDAMTGTAEMLFDYISECISDFLDKHQMKHKKLPLGFTFSFPVRHEDIDKGILLNWTKGFKASGAEGNNVVGLLRDAIK (ZFIN Staff)
  • Citations for Ab1-gck at ZFIN