Child pages
  • Ab1-atp2c1
Skip to end of metadata
Go to start of metadata

Add Comment

Antibody Name:

Ab1-atp2c1 from the ZFIN antibody database.

Other names, clone ids, catalog ids etc.

clone 2G1 , WH0027032M1 SIGMA Monoclonal Anti-ATP2C1 antibody produced in mouse , atp2c1

Does it work on zebrafish?

yes

Host organism

Mouse

Immunogen organism

Human

Antibody isotype

IgG1

Antibody type

monoclonal

Anatomical structures recognized
(use terms from the ZFIN Anatomical Ontology)

Recognized target molecules (gene names, domains, epitopes ...)

Suppliers

Sigma-Aldrich

Assays Tested

Assay

Prep

Worked

Notes

Notes

  • Imported from ZFIN Antibody page Ab1-atp2c1
  • Immunogen was "VQEYRSEKSLEELSKLVPPECHCVREGKLEHTLARDLVPGDTVCLSVGDRVPADLRLFEAVDLSIDESSLTGETTPCSKVTAPQPAATNGDLASRSNIAFMGTLVRCGKAKGVVIGTGENSEFGEVFKMMQAEEAPKTPLQKSMDLLGKQL (without GST)". From human ATP2C1. (ZFIN Staff)
  • Citations for Ab1-atp2c1 at ZFIN